Saturday, October 28, 2006 , 17.10

enjoy flamewars on the linux kernel mailing list

oscillare tra la voglia di prendersi a mattonate e la voglia di mattonare il resto del mondo.
come nasce un mattone, chiedeva un tempo Filippo Bellissima.
beh, se piovessero dal cielo staremmo tutti meglio.

LOCUS       AY531880                1083 bp    mRNA    linear   INV 14-APR-2004DEFINITION  Trichoplax adhaerens Hox/ParaHox protein (Trox-2) mRNA, complete            cds.ACCESSION   AY531880VERSION     AY531880.1  GI:45024754KEYWORDS    .SOURCE      Trichoplax adhaerens  ORGANISM  Trichoplax adhaerens            Eukaryota; Metazoa; Placozoa; Trichoplax.REFERENCE   1  (bases 1 to 1083)  AUTHORS   Jakob,W., Sagasser,S., Dellaporta,S., Holland,P., Kuhn,K. and            Schierwater,B.  TITLE     The Trox-2 Hox/ParaHox gene of Trichoplax (Placozoa) marks an            epithelial boundary  JOURNAL   Dev. Genes Evol. 214 (4), 170-175 (2004)   PUBMED   14997392REFERENCE   2  (bases 1 to 1083)  AUTHORS   Sagasser,S., Jakob,W., Dellaporta,S.L. and Schierwater,B.  TITLE     Direct Submission  JOURNAL   Submitted (22-JAN-2004) ITZ, Ecology & Evolution, TiHo Hannover,            Buenteweg 17d, Hannover, Lower Saxony D-30559, GermanyFEATURES             Location/Qualifiers     source          1..1083                     /organism="Trichoplax adhaerens"                     /mol_type="mRNA"                     /db_xref="taxon:10228"                     /clone="TriGre-3"     gene            1..1083                     /gene="Trox-2"     CDS             11..658                     /gene="Trox-2"                     /codon_start=1                     /product="Hox/ParaHox protein"                     /protein_id="AAS54997.1"                     /db_xref="GI:45024755"                     /translation="MANTSFKIESLIGPGNPTNAIINGSSMMAPFYLPSNYHSWPHDS                     NPNYSSCQVCIPNSTVTWPVLVKPSPIVDPAIYHQQQYRLDNHHHQSLPAFQGIQNTD                     TQQHPDLASDKTSMKSTSHSSRTKRIRTAYTSMQLLELEKEFNSSRYLSRLRRIEIAN                     MLNLSEKQVKIWFQNRRVKWKKDNKLDGQDHDENESKGSPDQYPLSDSEEELSNR"ORIGIN              1 caggtgaaac atggccaata catcttttaa aattgaaagt ttaatcggtc caggtaatcc       61 aaccaatgcc atcattaacg gttcttccat gatggcacca ttttatctgc cgtcgaatta      121 tcactcttgg cctcatgata gcaaccccaa ttattcatca tgtcaagtct gtatacccaa      181 ttcaactgtc acttggccag tactagtaaa gccatcgcct atagtcgatc ctgccatata      241 ccatcagcaa caatatcgat tggataacca tcatcaccaa tcattaccag ccttccaagg      301 aatccaaaat accgacactc aacaacatcc agatttagca tctgataaaa ctagcatgaa      361 atcgaccagt cattcttcca gaactaagcg tatacgaaca gcttatacca gtatgcagtt      421 attagaatta gaaaaggagt tcaacagtag ccgatatcta tcgcgactga ggaggattga      481 gattgctaat atgttaaatt tatcggagaa gcaagttaaa atatggttcc agaatcgtcg      541 cgtaaagtgg aaaaaggaca ataagttaga tggacaagat catgatgaaa acgaaagtaa      601 aggatctcct gatcaatatc cactatctga tagtgaagaa gaattatcta atcgataata      661 tactcaggcc taaatttgtg attgacacga tcataataat agttgctgat tatctactta      721 ttctaataca attataatat catccaatat tcaaatttag caaatttttc gcagaacgat      781 ttcttacagc cgcaatgaat tacattacaa taaactttca ttgtaagtta aagcgatgat      841 aaattaaatt agaatacgag taagtaccga aataagtaca attagtatac aaatgtttct      901 caataatcga gtatttaaat ccttaaggat gatatcagcc gaaaaaattt tcgcatctga      961 caataccttc aatcgtcatg catttgtgaa ataaaaataa aattatagca aaaaatagta     1021 ttctattcaa tccataagtc ttgttgcttg tatgaaacca taacttaata atcaataaaa     1081 aaa//



Friday, October 27, 2006 , 10.58

frasi di senso compiuto

l’aquila vola.
il cielo è azzurro.
i topi ballano.
la colazione è servita.
i gerbilli muoiono.
mangia la minestra o salta la finestra.

A074474 Number of iteration that first becomes smaller than the initial value if Collatz-function (A006370) is iterated, starting with numbers of form 4n+3. +20
7
6, 12, 9, 12, 7, 9, 97, 92, 7, 14, 9, 89, 7, 9, 12, 89, 7, 84, 9, 14, 7, 9, 74, 14, 7, 69, 9, 51, 7, 9, 14, 25, 7, 12, 9, 12, 7, 9, 66, 35, 7, 48, 9, 14, 7, 9, 12, 22, 7, 14, 9, 22, 7, 9, 14, 51, 7, 20, 9, 33, 7, 9, 45, 22, 7, 12, 9, 12, 7, 9, 40, 17, 7, 14, 9, 22, 7, 9, 12, 35, 7, 35, 9, 14



Thursday, October 26, 2006 , 10.35

drowning by numbers

A010456 Squares mod 95. +0
1
0, 1, 4, 5, 6, 9, 11, 16, 19, 20, 24, 25, 26, 30, 35, 36, 39, 44, 45, 49, 54, 55, 61, 64, 66, 74, 76, 80, 81, 85


Wednesday, October 25, 2006 , 11.48

l’avete voluta voi

da oggi su brullonulla solo sequenze numeriche.
morite.

A000055   Number of trees with n unlabeled nodes.
(Formerly M0791 N0299)
  +0
58
  1, 1, 1, 1, 2, 3, 6, 11, 23, 47, 106, 235, 551, 1301, 3159, 7741, 19320, 48629, 123867, 317955, 823065, 2144505, 5623756, 14828074, 39299897, 104636890, 279793450, 751065460, 2023443032, 5469566585, 14830871802, 40330829030, 109972410221


Sunday, October 22, 2006 , 18.12

la cravatta di Codreanu

ovvero, come l’estremismo tradizionalista ci insegna qualcosa sull’essere umano.
parte I.

l’editoriale di oggi rivolge lo sguardo (com’è ovvio, ardito ed indomito) alla filosofia e alla figura di Corneliu Zelea Codreanu, detto "il Capitano", il visionario condottiero ultratradizionalista e arci-antisemita fondatore della Guardia di Ferro e della Legione Arcangelo Michele nella Romania pre-WW II. si avvisa che l’editoriale di oggi è insopportabilmente noioso e intellettuale, quindi se volete i soliti negri rivolgetevi altrove.

ricordiamo innanzitutto il Codreanu come maestro di stile. si noti nell’immagine qui sopra la sua inconfondibile cravatta corta, simbolo (supponiamo) di austerità legionaria. portare un rombo al collo non è da tutti, ma il Capitano ci riesce con inarrivabile classe.

non mi dilungherò su chi sia Codreanu o cosa fosse la Guardia di Ferro. a questo sopperisce wikipedia. voglio invece qui soffermarmi su di lui in quanto summa del tradizionalismo. Codreanu ha portato all’estremo una serie di aspetti della destra tradizionalista che rivelano lati -alcuni, ma trascurati e non trascurabili- dell’essere dell’uomo. in questa prima parte commenteremo ordunque alcuni passi delle due principali opere del Capitano: l’autobiografica Guardia di Ferro e Il Capo di Cuib, in cui invece descrive i dettami della vita legionaria. entrambi i testi sono citati nella traduzione italiana delle celebri Edizioni di Ar di Franco Giorgio Freda, il quale di per sè richiederebbe un post a parte.

perchè scegliere Codreanu e non Evola, Guenon, Freda o chi per loro? il problema è che un filosofo come Evola è, appunto, filosofo. egli pensa, prima di tutto, ed è il pensare innanzitutto uno dei pilastri del marciume che il puro tradizionalismo anela estirpare nel mondo moderno. non a caso i testi di Codreanu non hanno -esplicitamente!- alcuna impostazione teorica. l’uno è un libretto autobiografico e propagandistico sulla Legione, l’altro è un insieme di precetti pratici e spirituali. azione, intuizione e non pensiero. nell’ingenuità, nella ritrosia di Codreanu al pensiero sta il suo potenziale di lente di ingrandimento:

Noi non abbiamo avuto nessun programma. Questo fatto farà sorgere certamente un grande punto interrogativo: com’è possibile una organizzazione politica senza alcun programma dettato dalla ragione, dalla mente d’un uomo o di più uomini?
Ma noi non c’eravamo uniti insieme perché pensavamo allo stesso modo, bensì perché sentivamo allo stesso modo; noi non avevamo lo stesso modo di pensare, ma la stessa struttura spirituale.
(grassetto mio)
Ciò significa che la statua di un’altra dea -La Ragione- sarebbe stata frantumata. Quella che il mondo aveva elevata contro Dio, noi -senza respingerla e disprezzarla- l’avremmo rimessa al suo vero posto, al servizio di Dio e del senso della vita.
Se non avevamo dunque né denari né programmi, avevamo in cambio Dio nelle anime ed Egli ci ispirava con la forza invincibile della fede.
(C.Z.Codreanu, Guardia di Ferro)

…[proposi] alcune misure politiche che consideravo più urgenti. Esse non erano il frutto d’una prolungata riflessione, di una profonda disamina ideologica, ma il risultato di pensieri immediati su ciò di cui aveva attualmente e urgentemente bisogno la stirpe romena. (C.Z.Codreanu, Guardia di Ferro)

questo è il primo tratto chiave del codreanesimo. la ragione per Codreanu è uno strumento di secondaria importanza, il cui senso -se c’è- è nel mettere in pratica, nel generare algoritmi atti a servire una struttura spirituale. Codreanu disprezza la "profonda disamina ideologica" come generatrice di dubbio e di divisioni capziose. Codreanu è esplicitamente superficiale e individua in questo un vanto, una linea d’azione, non una debolezza.
sebbene tale ideologia sia comune a buona parte (ma non solo) della Destra, è interessante vedere un uomo che esplicitamente fonda un movimento irreggimentato sull’irrazionalismo tout court. i legionari di Codreanu non hanno indicazioni su cosa fare, ma si muoveranno nella corretta direzione in quanto inevitabili agenti della propria "struttura spirituale", simili a cellule di un automa cellulare.

Codreanu esplicita e mette a fondamento dunque il tratto comune a tutti i popoli di essere, inevitabilmente, figli di un substrato. l’affermazione può apparire -trattando di un nazionalista- banale, quindi mi spiego. per Codreanu il substrato non è un punto di partenza, un dato fondamentale su cui costruire. per Codreanu è direttamente il punto di arrivo. l’aderire a una struttura non questionabile, dato dalla Tradizione è ciò che per Codreanu rappresenta ipso facto il senso dell’essere umano. ognuno di noi quando discute con l’altro da sè cerca di dare per scontati dei punti immateriali di "buon senso" che sono condivisi da una cultura, e il discutere con una cultura del tutto altra è sconcertante perchè tali punti non sono più condivisi. ma per Codreanu "discutere con l’altro" è affermazione priva di senso. il rapporto con l’altro per Codreanu può solo essere un combaciare delle proprie coordinate intime, mistiche ed insondabili. questo combaciare può essere o non essere, terzo non si dà (si può fare della maieutica sulle proprie coordinate spirituali, ma non si possono incastrare coordinate dissimili). il sistema di Codreanu è un sistema di assiomi che non ammettono teoremi. ragionare di politica per Codreanu è una contraddizione in termini: come si evince da altri passi della sua opera, per Codreanu, la politica è semplicemente l’espressione in Terra dello spirito dei suoi abitanti. Codreanu non deve riflettere sui bisogni della stirpe romena: esse soluzioni sgorgano inevitabili dal suo petto, così come il buon grano sgorga dalla buona terra.

si è fatto tardi. vi lascio dunque riflettere su queste semplici osservazioni, vedendo quali indizi possiamo tirarne fuori sulla struttura dell’essere umano. ci saranno una II e probaiblmente una III parte, la disamina è solo appena iniziata



Monday, October 16, 2006 , 19.18

il difficile rapporto con il migliore di sè

mi è stata posta l’annosa questione dell’inutilità del compact disc. un vero peccato che si diano tali colpi alle mie insalubri ossessioni (come quella di masterizzare su cd audio gli mp3 – puro nonsense, se non per il fatto che mi piace avere una corrispondenza 1:1 tra dischi e oggetti fisici. benchè poi, come facevo notare, della natura dell’oggetto fisico corrispondente abbia poco interesse, e accusassi di nonsense chi invece di tale natura si preoccupava. oh me trave, oh altri pagliuzze.).
la naturale soluzione di ciò, credo che la procrastinerò.

Life in the oceans must be sheer hell. A vast, merciless hell of permanent and immediate danger. So much of a hell that during evolution some species—including man—crawled, fled onto some small continents of solid land, where the Lessons of Darkness continue. (werner herzog)

non c’è bisogno di ddthroga quando c’è del malto di riso macrobiotico. non c’è niente che del malto di riso non possa lenire, o migliorare.



Thursday, October 5, 2006 , 22.46

mal d’africa

l’altro giorno leggevo repubblica sull’aereo bologna-dresda. leggere repubblica è spesso un’esperienza buffa: ad esempio con assoluta simpatia pubblicano l’intervista a un medico che guadagna 3500 euro netti mensili presentandolo come "tipico rappresentante del ceto medio", il quale, poverino, in fondo come passatempi ha solo guardarsi l’opera a Parigi un paio di volte al mese e mangiare due volte alla settimana al ristorante. poverino! povero piccolino! non è mica benestante, poverino!

la repubblica quel giorno presentava anche un editoriale di giorgio bocca. ora, giorgio bocca è il peggiore, e non aggiungo altro perchè altrimenti sono certo che è capace di querelarmi con il coltello fra i denti. il nostro amico g.b. elencava un salubre editoriale in cui si scagliava contro parziali revisioni finiane del giudizio sul colonialismo italiano. il bello è che egli, sorprendentemente, non elencava motivazioni del tipo il colonalismo fa male ai negri" com’era lecito aspettarsi. più furbescamente -e correttamente- elencava motivazioni del tipo "non è servito a un cazzo a noi italiani, era solo una spesa inutile".

il che può anche starmi bene, sennonchè a questo punto io capisco julius evola e desidero ingroppare una tigre a tutto spiano. cristiddio, il colonialismo è sogno e mito e leggenda e mal d’africa (che poi l’africa è un posto del cazzo invivibile e osceno e inadatto alla vita umana, colmo qual è di insetti orrendi e malaria e bestie puzzolenti e oranghi immondi e NEGRI ma transeat: è proprio nella sospensione dell’incredulità il discorso). il colonialismo è whisky bevuto al tramonto in una tenuta in namibia, mentre l’europa remota brucia nella guerra. il colonialismo sono navi colme di servi e di spie tedesche. il colonialismo è casablanca, è francese parlato con accenti estranei e tramonti che sono sempre gli ultimi. il colonialismo sono cose belle, porcodio.

finito il sogno ad occhi aperti, torniamo alla realtà. dopo la II guerra mondiale finisce il colonialismo, e cosa succede? sogni di gloria e di libertà? pace e letizia e ammmmore de’ popoli autodeterminantisi? mi pare di no.

altro che bavosate alla jovanotti come "cancella il debito". se a qualcuno fregasse veramente qualcosa del terzo mondo, la fast and furious solution è: ricominciare il colonialismo europeo in africa. non sto affatto scherzando. i vantaggi di questa cosa, se fatta come si deve:

  • ricostruzione/migliore gestione infrastrutture
  • regime democratico e rispettoso dei diritti civili
  • sfruttamento controllato delle risorse con diritti sindacali riconosciuti ai lavoratori
  • ricostruzione sanitaria
  • miglioramento netto della situazione turismo
  • crollo dei conflitti

 

sospetto che la romantica poesia del colonialismo anni ’20 lascerebbe il posto a negri infiocchettati che lavorano in hotel di lusso e kebabberie, ma comunque per i negri sarebbe sempre meglio che beccarsi la malattia del sonno mentre scavano in miniera? o no?

i vantaggi per l’occidente non mancherebbero. disincentivo all’immigrazione (perchè emigrare se puoi avere un lavoro decente lì dove stai?) e possibilità diretta di accedere alle risorse del terzo mondo in modo controllabile. bisognerà stare attenti all’accessibilità della fava di cacao da parte delle fanciulle speme d’italia, però.

in alternativa si brucia tutto e si fa una gigantesca pista per go-kart che vista dal satellite sembra la faccia di pinochet. non so, fate voi.



Tuesday, October 3, 2006 , 01.14

ci ho da combattere SATANA, io

il nuovo vero e proprio post è in arrivo. nel mentre, io maledico voi tutti perchè hanno spostato dr.house al mercoledì dalla domenica (si, brullonulla guarda dr.house con voluttà, e non mi sembra che questo debba stupire nessuno). evidentemente è successo qualche brutto pasticcio con satana: comprerò qualche calamita da mettere nelle mutande, mi circonderò di ventilatori e di plastica, la quale non può essere attraversata dal maligno. tzè. e chi credi di fottere, belzebubbo? non so se invece le rotatorie d’italia siano maledette o meno, ma in ogni caso inviterò dei pokemon al mio fianco: le mosse:fangata al 23, sfuriate al 29, supplica al 35, lacerazione al 41, riposo al 47, panciamburo al 53 , non posso perdere.



This work is licensed under a Creative Commons Attribution-Noncommercial-Share Alike 3.0 Unported License.
(c) 2020 brullonulla | powered by WordPress with Barecity